Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rabbit anti-Mouse CD163L1 Polyclonal Antibody | anti-CD163L1 antibody

CD163L1 Polyclonal Antibody

Gene Names
CD163L1; WC1; M160; CD163B; SCARI2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CD163L1, Antibody; CD163L1 Polyclonal Antibody; CD163B; M160; SCARI2; WC1; anti-CD163L1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICSDKADLDLRLVGAHSPCYGRLEVKYQGEWGTVCHDRWSTRNAAVVCKQLGCGKPMHVFGMTYFKEASGPIWLDDVSCIGNES
Sequence Length
1463
Applicable Applications for anti-CD163L1 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-550 of human CD163L1 (NP_777601.2).
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Secreted, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-CD163L1 antibody
This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. The SRCR family is defined by a 100-110 amino acid SRCR domain, which may mediate protein-protein interaction and ligand binding. The encoded protein contains twelve SRCR domains, a transmembrane region and a cytoplasmic domain. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CD163L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa/155kDa/159kDa/160kDa
NCBI Official Full Name
scavenger receptor cysteine-rich type 1 protein M160 isoform 1
NCBI Official Synonym Full Names
CD163 molecule like 1
NCBI Official Symbol
CD163L1
NCBI Official Synonym Symbols
WC1; M160; CD163B; SCARI2
NCBI Protein Information
scavenger receptor cysteine-rich type 1 protein M160
UniProt Protein Name
Scavenger receptor cysteine-rich type 1 protein M160
UniProt Gene Name
CD163L1
UniProt Synonym Gene Names
CD163B; M160

Similar Products

Product Notes

The CD163L1 cd163l1 (Catalog #AAA281270) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD163L1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD163L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CD163L1 cd163l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DCLHQNDVSV ICSDGADLEL RLADGSNNCS GRVEVRIHEQ WWTICDQNWK NEQALVVCKQ LGCPFSVFGS RRAKPSNEAR DIWINSISCT GNESALWDCT YDGKAKRTCF RRSDAGVICS DKADLDLRLV GAHSPCYGRL EVKYQGEWGT VCHDRWSTRN AAVVCKQLGC GKPMHVFGMT YFKEASGPIW LDDVSCIGNE S. It is sometimes possible for the material contained within the vial of "CD163L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.