Rabbit CD33 Polyclonal Antibody | anti-CD33 antibody
Anti-CD33 Antibody IHC-plus
Gene Names
CD33; p67; SIGLEC3; SIGLEC-3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CD33, Antibody; Anti-CD33 Antibody IHC-plus; CD33; CD33 antigen; CD33 molecule; gp67; SIGLEC-3, p67; CD33 antigen (gp67); SIGLEC3; anti-CD33 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Human CD33
Purity/Purification
Affinity Purified
Form/Format
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
3.39 mg/ml (varies by lot)
Sequence
YYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Applicable Applications for anti-CD33 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Family / Subfamily
Immunoglobulin / not assigned-Immunoglobulin
Host Note
CD33 antibody was produced in Rabbit
Immunogen Species
CD33 antibody was raised against Human
Immunogen
CD33 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 49-259 of human CD33 (NP_001763.3).
Disclaimer
Due to the highly specific nature of antibodies and antigens, we cannot predict or be held responsible with respect to how this antibody will behave in your systems. Researchers using this antibody should conduct optimization studies to achieve the most optimal result possible for their intended application.
Recommended Immunohistochemistry Protocol
The following protocol is a recommendation only, and AAA Biotech makes no guarantee of the results:
Tissue Preparation:
Formalin fixation and embedding in paraffin wax.
Tissue Sectioning:
Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C.
Deparaffinization:
Wash dry slides in 3 changes of xylene - 5 minutes each @ RT
Rehydration:
Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT
Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT
Wash slides in 1 change of 80% alcohol - 3 minutes @ RT
Rinse slides in gentle running distilled water - 5 minutes @ RT
Antigen retrieval:
Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes
Remove from heat and let stand at room temperature in buffer - 20 minutes
Rinse in 1X TBS with Tween (TBST) -1 minute @ RT
Immunostaining:
(Do not allow tissues to dry at any time during the staining procedure)
Apply a universal protein block - 20 minutes @ RT
Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT
Rinse slides in 1 X TBST - 1 minute @ RT
Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT
Rinse slides in 1X TBST -1 minute @ RT
Apply alkaline phosphatase streptavidin - 30 minutes @ RT
Rinse slides in 1X TBST -1 minute @ RT
Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT
Wash slides in distilled water - 1 minute @ RT
Dehydrate:
(This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB)
Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT
Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT
Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT
Wash slides in 3 changes of xylene - 1 minute each @ RT
Apply coverslip
Tissue Preparation:
Formalin fixation and embedding in paraffin wax.
Tissue Sectioning:
Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C.
Deparaffinization:
Wash dry slides in 3 changes of xylene - 5 minutes each @ RT
Rehydration:
Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT
Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT
Wash slides in 1 change of 80% alcohol - 3 minutes @ RT
Rinse slides in gentle running distilled water - 5 minutes @ RT
Antigen retrieval:
Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes
Remove from heat and let stand at room temperature in buffer - 20 minutes
Rinse in 1X TBS with Tween (TBST) -1 minute @ RT
Immunostaining:
(Do not allow tissues to dry at any time during the staining procedure)
Apply a universal protein block - 20 minutes @ RT
Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT
Rinse slides in 1 X TBST - 1 minute @ RT
Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT
Rinse slides in 1X TBST -1 minute @ RT
Apply alkaline phosphatase streptavidin - 30 minutes @ RT
Rinse slides in 1X TBST -1 minute @ RT
Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT
Wash slides in distilled water - 1 minute @ RT
Dehydrate:
(This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB)
Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT
Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT
Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT
Wash slides in 3 changes of xylene - 1 minute each @ RT
Apply coverslip
Preparation and Storage
Store at -20°C. Avoid freeze-thaw cycles.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 25kDa/33kDa/39kDa
Observed MW: 67kDa (by Western Blot)
Observed MW: 67kDa (by Western Blot)
NCBI Official Full Name
myeloid cell surface antigen CD33 isoform 1
NCBI Official Synonym Full Names
CD33 molecule
NCBI Official Symbol
CD33
NCBI Official Synonym Symbols
p67; SIGLEC3; SIGLEC-3
NCBI Protein Information
myeloid cell surface antigen CD33
UniProt Protein Name
Myeloid cell surface antigen CD33
UniProt Gene Name
CD33
UniProt Synonym Gene Names
SIGLEC3; Siglec-3
UniProt Entry Name
CD33_HUMAN
Similar Products
Product Notes
The CD33 cd33 (Catalog #AAA162209) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD33 Antibody IHC-plus reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD33 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CD33 cd33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YYDKNSPVHG YWFREGAIIS RDSPVATNKL DQEVQEETQG RFRLLGDPSR NNCSLSIVDA RRRDNGSYFF RMERGSTKYS YKSPQLSVHV TDLTHRPKIL IPGTLEPGHS KNLTCSVSWA CEQGTPPIFS WLSAAPTSLG PRTTHSSVLI ITPRPQDHGT NLTCQVKFAG AGVTTERTIQ LNVTYVPQNP TTGIFPGDGS GKQETRAGVV H. It is sometimes possible for the material contained within the vial of "CD33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.