Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197673_WB11.jpg WB (Western Blot) (WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit CD40LG Polyclonal Antibody | anti-CD40LG antibody

CD40LG antibody - middle region

Gene Names
CD40LG; IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
Reactivity
Tested Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CD40LG, Antibody; CD40LG antibody - middle region; anti-CD40LG antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
Sequence Length
261
Applicable Applications for anti-CD40LG antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 92%; Rat: 85%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD40LG
Protein Size (#AA)
261 amino acids
Protein Interactions
UBC; TRAF2; TRAF1; CD40; BIRC3; BIRC2; CRYAB; IGHG1; CD5L; CD40LG; TP53; IGKC; RNF128; HPR; APOA1;
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

product-image-AAA197673_WB11.jpg WB (Western Blot) (WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: CD40LGSample Type: Human Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA197673_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CD40LGSample Type: Human Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

IHC (Immunohistochemistry)

(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-CD40LG antibody)

product-image-AAA197673_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-CD40LG antibody)
Related Product Information for anti-CD40LG antibody
Target Description: CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
959
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
CD40 ligand
NCBI Official Synonym Full Names
CD40 ligand
NCBI Official Symbol
CD40LG
NCBI Official Synonym Symbols
IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
NCBI Protein Information
CD40 ligand
UniProt Protein Name
CD40 ligand
UniProt Gene Name
CD40LG
UniProt Synonym Gene Names
CD40L; TNFSF5; TRAP; CD40-L; TRAP
UniProt Entry Name
CD40L_HUMAN

Similar Products

Product Notes

The CD40LG cd40lg (Catalog #AAA197673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD40LG antibody - middle region reacts with Tested Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CD40LG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CD40LG cd40lg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENSFEMQKGD QNPQIAAHVI SEASSKTTSV LQWAEKGYYT MSNNLVTLEN. It is sometimes possible for the material contained within the vial of "CD40LG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.