Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201561_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CD46Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CD46 Polyclonal Antibody | anti-CD46 antibody

CD46 Antibody - middle region

Gene Names
CD46; MCP; TLX; AHUS2; MIC10; TRA2.10
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CD46, Antibody; CD46 Antibody - middle region; anti-CD46 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: VLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIY
Sequence Length
336
Applicable Applications for anti-CD46 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD46
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CD46Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201561_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CD46Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CD46Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA201561_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: CD46Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-CD46 antibody
The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. The encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-CD46 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
membrane cofactor protein isoform 1
NCBI Official Synonym Full Names
CD46 molecule
NCBI Official Symbol
CD46
NCBI Official Synonym Symbols
MCP; TLX; AHUS2; MIC10; TRA2.10
NCBI Protein Information
membrane cofactor protein
UniProt Protein Name
Membrane cofactor protein
UniProt Gene Name
CD46
UniProt Synonym Gene Names
MCP; MIC10
UniProt Entry Name
MCP_HUMAN

Similar Products

Product Notes

The CD46 cd46 (Catalog #AAA201561) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD46 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD46 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CD46 cd46 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLCTPPPKIK NGKHTFSEVE VFEYLDAVTY SCDPAPGPDP FSLIGESTIY. It is sometimes possible for the material contained within the vial of "CD46, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.