Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA280968_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using CD8A antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse CD8A Polyclonal Antibody | anti-CD8A antibody

CD8A Polyclonal Antibody

Gene Names
CD8A; CD8; MAL; p32; Leu2
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
CD8A, Antibody; CD8A Polyclonal Antibody; CD8; Leu2; MAL; p32; anti-CD8A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Sequence Length
235
Applicable Applications for anti-CD8A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human CD8A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Secreted, Single-pass type I membrane protein
Positive Samples
Mouse pancreas
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse spleen using CD8A antibody at dilution of 1:100 (40x lens).)

product-image-AAA280968_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using CD8A antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using CD8A antibody at dilution of 1:100 (40x lens).)

product-image-AAA280968_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human tonsil using CD8A antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of mouse pancreas, using CD8A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA280968_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of mouse pancreas, using CD8A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-CD8A antibody
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CD8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
925
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 21kDa; 25kDa; 30kDa
Observed: 30kDa
NCBI Official Full Name
T-cell surface glycoprotein CD8 alpha chain isoform 1
NCBI Official Synonym Full Names
CD8a molecule
NCBI Official Symbol
CD8A
NCBI Official Synonym Symbols
CD8; MAL; p32; Leu2
NCBI Protein Information
T-cell surface glycoprotein CD8 alpha chain
UniProt Protein Name
T-cell surface glycoprotein CD8 alpha chain
UniProt Gene Name
CD8A
UniProt Synonym Gene Names
MAL

Similar Products

Product Notes

The CD8A cd8a (Catalog #AAA280968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD8A Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD8A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD8A cd8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQFRVSPLDR TWNLGETVEL KCQVLLSNPT SGCSWLFQPR GAAASPTFLL YLSQNKPKAA EGLDTQRFSG KRLGDTFVLT LSDFRRENEG YYFCSALSNS IMYFSHFVPV FLPAKPTTTP APRPPTPAPT IASQPLSLRP EACRPAAGGA VHTRGLDFAC D. It is sometimes possible for the material contained within the vial of "CD8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.