Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200914_WB13.jpg WB (Western Blot) (WB Suggested Anti-CDC26 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit CDC26 Polyclonal Antibody | anti-CDC26 antibody

CDC26 antibody - C-terminal region

Gene Names
CDC26; APC12; ANAPC12; C9orf17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDC26, Antibody; CDC26 antibody - C-terminal region; anti-CDC26 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF
Sequence Length
85
Applicable Applications for anti-CDC26 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDC26
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CDC26 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA200914_WB13.jpg WB (Western Blot) (WB Suggested Anti-CDC26 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

WB (Western Blot)

(Lanes:1: 20ug Jukart cell lysate, 2: 20ug untransfected Hela lysate, 3: 20ug GFP-STAMBP transfected HeLa lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-HRPSecondary Antibody Dilution:1:2000Gene Name:CDC26Submitted by:Dr. N. Blake, University of Liverpool)

product-image-AAA200914_WB15.jpg WB (Western Blot) (Lanes:1: 20ug Jukart cell lysate, 2: 20ug untransfected Hela lysate, 3: 20ug GFP-STAMBP transfected HeLa lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-HRPSecondary Antibody Dilution:1:2000Gene Name:CDC26Submitted by:Dr. N. Blake, University of Liverpool)
Related Product Information for anti-CDC26 antibody
This is a rabbit polyclonal antibody against CDC26. It was validated on Western Blot

Target Description: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins.
Product Categories/Family for anti-CDC26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
anaphase-promoting complex subunit CDC26
NCBI Official Synonym Full Names
cell division cycle 26
NCBI Official Symbol
CDC26
NCBI Official Synonym Symbols
APC12; ANAPC12; C9orf17
NCBI Protein Information
anaphase-promoting complex subunit CDC26
UniProt Protein Name
Anaphase-promoting complex subunit CDC26
UniProt Gene Name
CDC26
UniProt Synonym Gene Names
ANAPC12; C9orf17; APC12
UniProt Entry Name
CDC26_HUMAN

Similar Products

Product Notes

The CDC26 cdc26 (Catalog #AAA200914) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC26 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDC26 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CDC26 cdc26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQKEDVEVVG GSDGEGAIGL SSDPKSREQM INDRIGYKPQ PKPNNRSSQF. It is sometimes possible for the material contained within the vial of "CDC26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.