Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200435_WB11.jpg WB (Western Blot) (WB Suggested Anti-CDC42EP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that CDC42EP4 is expressed in 721_B)

Rabbit CDC42EP4 Polyclonal Antibody | anti-CDC42EP4 antibody

CDC42EP4 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CDC42EP4; CEP4; BORG4; KAIA1777
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDC42EP4, Antibody; CDC42EP4 antibody - N-terminal region; anti-CDC42EP4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ
Sequence Length
356
Applicable Applications for anti-CDC42EP4 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42EP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CDC42EP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that CDC42EP4 is expressed in 721_B)

product-image-AAA200435_WB11.jpg WB (Western Blot) (WB Suggested Anti-CDC42EP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that CDC42EP4 is expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: CDC42EP4Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200435_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CDC42EP4Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CDC42EP4Sample Type: HelaAntibody Dilution: 1.0ug/mlCDC42EP4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA200435_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CDC42EP4Sample Type: HelaAntibody Dilution: 1.0ug/mlCDC42EP4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Related Product Information for anti-CDC42EP4 antibody
This is a rabbit polyclonal antibody against CDC42EP4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.
Product Categories/Family for anti-CDC42EP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
cdc42 effector protein 4
NCBI Official Synonym Full Names
CDC42 effector protein 4
NCBI Official Symbol
CDC42EP4
NCBI Official Synonym Symbols
CEP4; BORG4; KAIA1777
NCBI Protein Information
cdc42 effector protein 4
UniProt Protein Name
Cdc42 effector protein 4
UniProt Gene Name
CDC42EP4
UniProt Synonym Gene Names
BORG4; CEP4
UniProt Entry Name
BORG4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDC42EP4 cdc42ep4 (Catalog #AAA200435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC42EP4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42EP4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CDC42EP4 cdc42ep4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSSKRSLLSR KFRGSKRSQS VTRGEREQRD MLGSLRDSAL FVKNAMSLPQ. It is sometimes possible for the material contained within the vial of "CDC42EP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.