Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201422_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: Cdk15Sample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Cdk15 Polyclonal Antibody | anti-CDK15 antibody

Cdk15 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Cdk15; Pftk2; Als2cr7
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cdk15, Antibody; Cdk15 Antibody - N-terminal region; anti-CDK15 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS
Sequence Length
433
Applicable Applications for anti-CDK15 antibody
WB (Western Blot)
Homology
Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 85%; Rabbit: 92%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cdk15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: Cdk15Sample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201422_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: Cdk15Sample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CDK15Sample Tissue: Mouse Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA201422_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CDK15Sample Tissue: Mouse Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDK15 antibody
This is a rabbit polyclonal antibody against Cdk15. It was validated on Western Blot

Target Description: Cdk15 is a Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin.
Product Categories/Family for anti-CDK15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
cyclin-dependent kinase 15 isoform 1
NCBI Official Synonym Full Names
cyclin-dependent kinase 15
NCBI Official Symbol
Cdk15
NCBI Official Synonym Symbols
Pftk2; Als2cr7
NCBI Protein Information
cyclin-dependent kinase 15
UniProt Protein Name
Cyclin-dependent kinase 15
UniProt Gene Name
Cdk15
UniProt Synonym Gene Names
Als2cr7; Pftk2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDK15 cdk15 (Catalog #AAA201422) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cdk15 Antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cdk15 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CDK15 cdk15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASFHPRGLEA ASAQKLKSKR PRSNSDSFQE ENLRQGLPWK KSLPFGAASS. It is sometimes possible for the material contained within the vial of "Cdk15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.