Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198334_WB11.jpg WB (Western Blot) (WB Suggested Anti-CDK5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit CDK5 Polyclonal Antibody | anti-CDK5 antibody

CDK5 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CDK5; LIS7; PSSALRE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
CDK5, Antibody; CDK5 antibody - C-terminal region; anti-CDK5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFC
Sequence Length
292
Applicable Applications for anti-CDK5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDK5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CDK5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA198334_WB11.jpg WB (Western Blot) (WB Suggested Anti-CDK5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: CDK5Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA198334_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: CDK5Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Zebrafish EmbryoDilution: 1:100, 1:200)

product-image-AAA198334_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Zebrafish EmbryoDilution: 1:100, 1:200)
Related Product Information for anti-CDK5 antibody
This is a rabbit polyclonal antibody against CDK5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CDK5 is probably involved in the control of the cell cycle. CDK5 can interact with d1 and d3-type G1 cyclins and phosphorylate histone H1, tau, MAP2 and NF-H and NF-M. CDK5 can also interacts with p35 which activates the kinase

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
cyclin-dependent-like kinase 5 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase 5
NCBI Official Symbol
CDK5
NCBI Official Synonym Symbols
LIS7; PSSALRE
NCBI Protein Information
cyclin-dependent-like kinase 5
UniProt Protein Name
Cyclin-dependent kinase 5
UniProt Gene Name
CDK5
UniProt Synonym Gene Names
CDKN5; TPKII catalytic subunit
UniProt Entry Name
CDK5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDK5 cdk5 (Catalog #AAA198334) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CDK5 cdk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MYPATTSLVN VVPKLNATGR DLLQNLLKCN PVQRISAEEA LQHPYFSDFC. It is sometimes possible for the material contained within the vial of "CDK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.