Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281683_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using CDKL3 Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit CDKL3 Polyclonal Antibody | anti-CDKL3 antibody

CDKL3 Rabbit pAb

Gene Names
CDKL3; NKIAMRE
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CDKL3, Antibody; CDKL3 Rabbit pAb; CDKL3; NKIAMRE; anti-CDKL3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN
Applicable Applications for anti-CDKL3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKL3 (NP_001107047).
Positive Samples
HeLa, LO2, Mouse brain, Mouse liver, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using CDKL3 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281683_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using CDKL3 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CDKL3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281683_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CDKL3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-CDKL3 antibody
Background: The protein encoded by this gene is a member of cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This gene was identified as a gene absent in leukemic patients with chromosome 5q deletion. This loss may be an important determinant of dysmyelopoiesis. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,514 Da
NCBI Official Full Name
cyclin-dependent kinase-like 3 isoform 1
NCBI Official Synonym Full Names
cyclin-dependent kinase-like 3
NCBI Official Symbol
CDKL3
NCBI Official Synonym Symbols
NKIAMRE
NCBI Protein Information
cyclin-dependent kinase-like 3; serine-threonine protein kinase NKIAMRE; serine/threonine-protein kinase NKIAMRE
UniProt Protein Name
Cyclin-dependent kinase-like 3
UniProt Gene Name
CDKL3
UniProt Synonym Gene Names
NKIAMRE
UniProt Entry Name
CDKL3_HUMAN

Similar Products

Product Notes

The CDKL3 cdkl3 (Catalog #AAA281683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKL3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDKL3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CDKL3 cdkl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEMYETLGKV GEGSYGTVMK CKHKNTGQIV AIKIFYERPE QSVNKIAMRE IKFLKQFHHE NLVNLIEVFR QKKKIHLVFE FIDHTVLDEL QHYCHGLESK RLRKYLFQIL RAIDYLHSNN. It is sometimes possible for the material contained within the vial of "CDKL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.