Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200971_WB13.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Recognizes isoform 2 in this experiment.)

Rabbit anti-Human CDKL5 Polyclonal Antibody | anti-CDKL5 antibody

CDKL5 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CDKL5; ISSX; STK9; EIEE2; CFAP247
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDKL5, Antibody; CDKL5 antibody - C-terminal region; anti-CDKL5 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT
Sequence Length
1030
Applicable Applications for anti-CDKL5 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDKL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Recognizes isoform 2 in this experiment.)

product-image-AAA200971_WB13.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Recognizes isoform 2 in this experiment.)

WB (Western Blot)

(WB Suggested Anti-CDKL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateCDKL5 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA200971_WB15.jpg WB (Western Blot) (WB Suggested Anti-CDKL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateCDKL5 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-CDKL5 antibody
This is a rabbit polyclonal antibody against CDKL5. It was validated on Western Blot

Target Description: CDKL5 is a member of Ser/Thr protein kinase family. This protein is a phosphorylated protein with protein kinase activity. Mutations in this CDKL5 gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT).
Product Categories/Family for anti-CDKL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
cyclin-dependent kinase-like 5 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase like 5
NCBI Official Symbol
CDKL5
NCBI Official Synonym Symbols
ISSX; STK9; EIEE2; CFAP247
NCBI Protein Information
cyclin-dependent kinase-like 5
UniProt Protein Name
Cyclin-dependent kinase-like 5
UniProt Gene Name
CDKL5
UniProt Synonym Gene Names
STK9
UniProt Entry Name
CDKL5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDKL5 cdkl5 (Catalog #AAA200971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKL5 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKL5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CDKL5 cdkl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQASGGSSNI RQEPAPKGRP ALQLPDGGCD GRRQRHHSGP QDRRFMLRTT. It is sometimes possible for the material contained within the vial of "CDKL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.