WB (Western Blot)
(WB Suggested Anti-CEBPD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateCEBPD is supported by BioGPS gene expression data to be expressed in COLO205)
Rabbit CEBPD Polyclonal Antibody | anti-CEBPD antibody
CEBPD antibody - middle region
Gene Names
CEBPD; CELF; CRP3; C/EBP-delta; NF-IL6-beta
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEBPD, Antibody; CEBPD antibody - middle region; anti-CEBPD antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG
Sequence Length
269
Applicable Applications for anti-CEBPD antibody
WB (Western Blot)
Homology
Cow: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CEBPD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-CEBPD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateCEBPD is supported by BioGPS gene expression data to be expressed in COLO205)
WB (Western Blot)
(WB Suggested Anti-CEBPD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateCEBPD is supported by BioGPS gene expression data to be expressed in COLO205)
IHC (Immunohistochemistry)
(Rabbit Anti-CEBPD AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-CEBPD AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CEBPD antibody
This is a rabbit polyclonal antibody against CEBPD. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CEBPD is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inf
Target Description: CEBPD is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inf
Product Categories/Family for anti-CEBPD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
CCAAT/enhancer-binding protein delta
NCBI Official Synonym Full Names
CCAAT enhancer binding protein delta
NCBI Official Symbol
CEBPD
NCBI Official Synonym Symbols
CELF; CRP3; C/EBP-delta; NF-IL6-beta
NCBI Protein Information
CCAAT/enhancer-binding protein delta
UniProt Protein Name
CCAAT/enhancer-binding protein delta
UniProt Gene Name
CEBPD
UniProt Synonym Gene Names
C/EBP delta; NF-IL6-beta
UniProt Entry Name
CEBPD_HUMAN
Similar Products
Product Notes
The CEBPD cebpd (Catalog #AAA198345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEBPD antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CEBPD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CEBPD cebpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNQEMQQKLV ELSAENEKLH QRVEQLTRDL AGLRQFFKQL PSPPFLPAAG. It is sometimes possible for the material contained within the vial of "CEBPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.