Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200429_WB13.jpg WB (Western Blot) (WB Suggested Anti-CENPI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateCENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit anti-Human CENPI Polyclonal Antibody | anti-CENPI antibody

CENPI antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CENPI; LRPR1; CENP-I; FSHPRH1
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
CENPI, Antibody; CENPI antibody - N-terminal region; anti-CENPI antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
Sequence Length
756
Applicable Applications for anti-CENPI antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CENPI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateCENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

product-image-AAA200429_WB13.jpg WB (Western Blot) (WB Suggested Anti-CENPI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateCENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

IF (Immunofluorescence)

(Sample Type : DNA/ACA)

product-image-AAA200429_IF15.jpg IF (Immunofluorescence) (Sample Type : DNA/ACA)
Related Product Information for anti-CENPI antibody
This is a rabbit polyclonal antibody against CENPI. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.
Product Categories/Family for anti-CENPI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
centromere protein I isoform 1
NCBI Official Synonym Full Names
centromere protein I
NCBI Official Symbol
CENPI
NCBI Official Synonym Symbols
LRPR1; CENP-I; FSHPRH1
NCBI Protein Information
centromere protein I
UniProt Protein Name
Centromere protein I
UniProt Gene Name
CENPI
UniProt Synonym Gene Names
FSHPRH1; ICEN19; LRPR1; CENP-I
UniProt Entry Name
CENPI_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CENPI cenpi (Catalog #AAA200429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENPI antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CENPI can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CENPI cenpi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPQKRVKNVQ AQNRTSQGSS SFQTTLSAWK VKQDPSNSKN ISKHGQNNPV. It is sometimes possible for the material contained within the vial of "CENPI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.