Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199059_WB8.jpg WB (Western Blot) (WB Suggested Anti-CES2 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit CES2 Polyclonal Antibody | anti-CES2 antibody

CES2 antibody - C-terminal region

Gene Names
CES2; iCE; CE-2; PCE-2; CES2A1
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CES2, Antibody; CES2 antibody - C-terminal region; anti-CES2 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
Sequence Length
623
Applicable Applications for anti-CES2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CES2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CES2 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA199059_WB8.jpg WB (Western Blot) (WB Suggested Anti-CES2 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateCES2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA199059_WB10.jpg WB (Western Blot) (WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateCES2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

IHC (Immunohistochemisry)

(Rabbit Anti-CES2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult KidneyObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199059_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-CES2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult KidneyObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohiostchemistry)

(Rabbit Anti-CES2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA199059_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CES2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

IHC (Immunohistochemistry)

(Rabbit Anti-CES2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199059_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CES2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CES2 antibody
This is a rabbit polyclonal antibody against CES2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-CES2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
cocaine esterase isoform 1
NCBI Official Synonym Full Names
carboxylesterase 2
NCBI Official Symbol
CES2
NCBI Official Synonym Symbols
iCE; CE-2; PCE-2; CES2A1
NCBI Protein Information
cocaine esterase
UniProt Protein Name
Cocaine esterase
UniProt Gene Name
CES2
UniProt Synonym Gene Names
ICE; CE-2; hCE-2
UniProt Entry Name
EST2_HUMAN

Similar Products

Product Notes

The CES2 ces2 (Catalog #AAA199059) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CES2 antibody - C-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CES2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CES2 ces2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HWPLFDQEEQ YLQLNLQPAV GRALKAHRLQ FWKKALPQKI QELEEPEERH. It is sometimes possible for the material contained within the vial of "CES2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.