Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201413_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CES4ASample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CES4A Polyclonal Antibody | anti-CES4A antibody

CES4A Antibody - C-terminal region

Gene Names
CES4A; CES6; CES8
Reactivity
Tested Reactivity : Human
Predicted Species Reactivity: Cow, Guinea Pig, Horse, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CES4A, Antibody; CES4A Antibody - C-terminal region; anti-CES4A antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity : Human
Predicted Species Reactivity: Cow, Guinea Pig, Horse, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KYWANFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFW
Sequence Length
514
Applicable Applications for anti-CES4A antibody
WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CES4A.
Protein Size
514 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CES4ASample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201413_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CES4ASample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CES4A antibody
This is a rabbit polyclonal antibody against CES4A. It was validated on Western Blot

Target Description: This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They also participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene, also called CES6, encodes a secreted enzyme, and may play a role in the detoxification of drugs and xenobiotics in neural and other tissues of the body and in the cerebrospinal fluid. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature and/or biological validity of some variants have not been determined.
Product Categories/Family for anti-CES4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
carboxylesterase 4A isoform 3
NCBI Official Synonym Full Names
carboxylesterase 4A
NCBI Official Symbol
CES4A
NCBI Official Synonym Symbols
CES6; CES8
NCBI Protein Information
carboxylesterase 4A
UniProt Protein Name
Pyrethroid hydrolase Ces2a
UniProt Gene Name
Ces2a
UniProt Synonym Gene Names
Ces6
UniProt Entry Name
EST2A_MOUSE

Similar Products

Product Notes

The CES4A ces2a (Catalog #AAA201413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CES4A Antibody - C-terminal region reacts with Tested Reactivity : Human Predicted Species Reactivity: Cow, Guinea Pig, Horse, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CES4A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CES4A ces2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYWANFARTG NPNDGNLPCW PRYNKDEKYL QLDFTTRVGM KLKEKKMAFW. It is sometimes possible for the material contained within the vial of "CES4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.