Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282401_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of GFPRNF168 transgenic U2OS cells using CETN2 antibody (AAA282401). Green?GFP-RNF168 fusion protein expression for DNA damage marker.Blue: DAPI for nuclear staining. RNF168 (GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.)

Rabbit CETN2 Polyclonal Antibody | anti-CETN2 antibody

CETN2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CETN2; CALT; CEN2
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
CETN2, Antibody; CETN2 Rabbit pAb; CALT; CEN2; anti-CETN2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Applicable Applications for anti-CETN2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Positive Samples
Rat spleen
Cellular Location
Cytoplasm, Nucleus, centriole, centrosome, cytoskeleton, microtubule organizing center
Research Area
Epigenetics Nuclear Signaling, DNA Damage Repair, Signal Transduction, Cell Biology Developmental Biology, Cell Cycle, Centrosome, Neuroscience, Calcium Signaling
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CETN2 (NP_004335.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of GFPRNF168 transgenic U2OS cells using CETN2 antibody (AAA282401). Green?GFP-RNF168 fusion protein expression for DNA damage marker.Blue: DAPI for nuclear staining. RNF168 (GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.)

product-image-AAA282401_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of GFPRNF168 transgenic U2OS cells using CETN2 antibody (AAA282401). Green?GFP-RNF168 fusion protein expression for DNA damage marker.Blue: DAPI for nuclear staining. RNF168 (GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using CETN2 antibody (AAA282401).)

product-image-AAA282401_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using CETN2 antibody (AAA282401).)

WB (Western Blot)

(Western blot analysis of Rat spleen, using CETN2 Rabbit pAb (AAA282401) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)

product-image-AAA282401_WB15.jpg WB (Western Blot) (Western blot analysis of Rat spleen, using CETN2 Rabbit pAb (AAA282401) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)
Related Product Information for anti-CETN2 antibody
Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.
Product Categories/Family for anti-CETN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,738 Da
NCBI Official Full Name
centrin-2
NCBI Official Synonym Full Names
centrin, EF-hand protein, 2
NCBI Official Symbol
CETN2
NCBI Official Synonym Symbols
CALT; CEN2
NCBI Protein Information
centrin-2; caltractin (20kD calcium-binding protein)
UniProt Protein Name
Centrin-2
UniProt Gene Name
CETN2
UniProt Synonym Gene Names
CALT; CEN2
UniProt Entry Name
CETN2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CETN2 cetn2 (Catalog #AAA282401) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CETN2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CETN2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CETN2 cetn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASNFKKANM ASSSQRKRMS PKPELTEEQK QEIREAFDLF DADGTGTIDV KELKVAMRAL GFEPKKEEIK KMISEIDKEG TGKMNFGDFL TVMTQKMSEK DTKEEILKAF KLFDDDETGK ISFKNLKRVA KELGENLTDE ELQEMIDEAD RDGDGEVSEQ EFLRIMKKTS LY. It is sometimes possible for the material contained within the vial of "CETN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.