Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199636_WB13.jpg WB (Western Blot) (WB Suggested Anti-C21orf59 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)

Rabbit CFAP298 Polyclonal Antibody | anti-CFAP298 antibody

CFAP298 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CFAP298; Kur; FBB18; CILD26; C21orf48; C21orf59
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CFAP298, Antibody; CFAP298 Antibody - N-terminal region; anti-CFAP298 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
Sequence Length
290
Applicable Applications for anti-CFAP298 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C21orf59 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)

product-image-AAA199636_WB13.jpg WB (Western Blot) (WB Suggested Anti-C21orf59 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)

WB (Western Blot)

(WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateC21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA199636_WB15.jpg WB (Western Blot) (WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateC21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-CFAP298 antibody
This is a rabbit polyclonal antibody against C21orf59. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene.
Product Categories/Family for anti-CFAP298 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
cilia- and flagella-associated protein 298 isoform 1
NCBI Official Synonym Full Names
cilia and flagella associated protein 298
NCBI Official Symbol
CFAP298
NCBI Official Synonym Symbols
Kur; FBB18; CILD26; C21orf48; C21orf59
NCBI Protein Information
cilia- and flagella-associated protein 298
UniProt Protein Name
UPF0769 protein C21orf59
UniProt Gene Name
C21orf59
UniProt Synonym Gene Names
C21orf48
UniProt Entry Name
CU059_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CFAP298 c21orf59 (Catalog #AAA199636) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CFAP298 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CFAP298 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CFAP298 c21orf59 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLLHVKRGDE SQFLLQAPGS TELEELTVQV ARVYNGRLKV QRLCSEMEEL. It is sometimes possible for the material contained within the vial of "CFAP298, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.