Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28333_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit CHCHD2 Polyclonal Antibody | anti-CHCHD2 antibody

[KO Validated] CHCHD2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CHCHD2; C7orf17
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
CHCHD2, Antibody; [KO Validated] CHCHD2 Rabbit pAb; CHCHD2; C7orf17; MNRR1; NS2TP; PARK22; anti-CHCHD2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR
Applicable Applications for anti-CHCHD2 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1).
Cellular Location
Nucleus
Positive Samples
HT-29, 293T, HepG2, U-87MG, mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28333_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28333_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28333_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28333_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Rat ovary using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28333_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Rat ovary using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Mouse kidney using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28333_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Mouse kidney using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CHCHD2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28333_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CHCHD2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CHCHD2 antibody
Background: The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,513 Da
NCBI Official Full Name
coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial
NCBI Official Synonym Full Names
coiled-coil-helix-coiled-coil-helix domain containing 2
NCBI Official Symbol
CHCHD2
NCBI Official Synonym Symbols
C7orf17
NCBI Protein Information
coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial; NS2TP; 16.7kD protein; HCV NS2 trans-regulated protein; aging-associated gene 10 protein
UniProt Protein Name
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial
UniProt Gene Name
CHCHD2
UniProt Synonym Gene Names
C7orf17; NS2TP
UniProt Entry Name
CHCH2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CHCHD2 chchd2 (Catalog #AAA28333) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] CHCHD2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHCHD2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the CHCHD2 chchd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLGHAITGGF SGGSNAEPAR PDITYQEPQG TQPAQQQQPC LYEIKQFLEC AQNQGDIKLC EGFNEVLKQC R. It is sometimes possible for the material contained within the vial of "CHCHD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.