Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200190_WB10.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Rabbit CHI3L1 Polyclonal Antibody | anti-CHI3L1 antibody

CHI3L1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CHI3L1; GP39; ASRT7; GP-39; YK-40; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39
Reactivity
Tested Reactivity: Human, Monkey
Predicted Reactivity: Human, Rat, Cow, Dog, Goat, Pig, Rabbit
Applications
Western Blot, Immunofluorescence
Purity
Affiniy Purified
Synonyms
CHI3L1, Antibody; CHI3L1 antibody - middle region; anti-CHI3L1 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human, Monkey
Predicted Reactivity: Human, Rat, Cow, Dog, Goat, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affiniy Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
Applicable Applications for anti-CHI3L1 antibody
WB (Western Blot), IF (Immunofluorescence)
Protein Size (# AA)
383 amino acids
Protein Interactions
CHI3L1;
Blocking Peptide
For anti-CHI3L1 (MBS3210512) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1
Predicted Homology
Based on Immunogen Sequence: Cow: 92%; Dog: 77%; Goat: 92%; Human: 100%; Pig: 92%; Rabbit: 100%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

product-image-AAA200190_WB10.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

WB (Western Blot)

(Host: RabbitTarget Name: CHI3L1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200190_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CHI3L1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CHI3L1Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 3ug/ml)

product-image-AAA200190_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CHI3L1Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 3ug/ml)

IF (Immunofluorescence)

(Simian immunodeficiency virus encephalitis)

product-image-AAA200190_IF15.jpg IF (Immunofluorescence) (Simian immunodeficiency virus encephalitis)
Related Product Information for anti-CHI3L1 antibody
CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Product Categories/Family for anti-CHI3L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
chitinase-3-like protein 1
NCBI Official Synonym Full Names
chitinase 3 like 1
NCBI Official Symbol
CHI3L1
NCBI Official Synonym Symbols
GP39; ASRT7; GP-39; YK-40; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39
NCBI Protein Information
chitinase-3-like protein 1
UniProt Protein Name
Chitinase-3-like protein 1
UniProt Gene Name
CHI3L1
UniProt Synonym Gene Names
CGP-39; GP-39; hCGP-39
UniProt Entry Name
CH3L1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CHI3L1 chi3l1 (Catalog #AAA200190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHI3L1 antibody - middle region reacts with Tested Reactivity: Human, Monkey Predicted Reactivity: Human, Rat, Cow, Dog, Goat, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CHI3L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CHI3L1 chi3l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LDFISIMTYD FHGAWRGTTG HHSPLFRGQE DASPDRFSNT DYAVGYMLRL. It is sometimes possible for the material contained within the vial of "CHI3L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.