Rabbit CHIA Polyclonal Antibody | anti-CHIA antibody
CHIA antibody - middle region
Gene Names
CHIA; CHIT2; AMCASE; TSA1902
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHIA, Antibody; CHIA antibody - middle region; anti-CHIA antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
Sequence Length
368
Applicable Applications for anti-CHIA antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHIA
Protein Size (#AA)
368 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CHIA antibody
This is a rabbit polyclonal antibody against CHIA. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Target Description: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Product Categories/Family for anti-CHIA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
acidic mammalian chitinase isoform a
NCBI Official Synonym Full Names
chitinase acidic
NCBI Official Symbol
CHIA
NCBI Official Synonym Symbols
CHIT2; AMCASE; TSA1902
NCBI Protein Information
acidic mammalian chitinase
UniProt Protein Name
Acidic mammalian chitinase
UniProt Gene Name
CHIA
UniProt Synonym Gene Names
AMCase
UniProt Entry Name
CHIA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CHIA chia (Catalog #AAA199146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHIA antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHIA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHIA chia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSWEGYTGEN SPLYKYPTDT GSNAYLNVDY VMNYWKDNGA PAEKLIVGFP. It is sometimes possible for the material contained within the vial of "CHIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
