Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201378_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: Chmp4cSample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Chmp4c Polyclonal Antibody | anti-CHMP4C antibody

Chmp4c Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Chmp4c; Shax3; Snf7-3; 2010012P02Rik; 2210015K02Rik; 2310010I16Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Chmp4c, Antibody; Chmp4c Antibody - C-terminal region; anti-CHMP4C antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
Sequence Length
232
Applicable Applications for anti-CHMP4C antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: Chmp4cSample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201378_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: Chmp4cSample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CHMP4CSample Tissue: Mouse Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA201378_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CHMP4CSample Tissue: Mouse Mouse SpleenAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHMP4C antibody
This is a rabbit polyclonal antibody against Chmp4c. It was validated on Western Blot

Target Description: Chmp4c is a probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.
Product Categories/Family for anti-CHMP4C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
charged multivesicular body protein 4c
NCBI Official Synonym Full Names
charged multivesicular body protein 4C
NCBI Official Symbol
Chmp4c
NCBI Official Synonym Symbols
Shax3; Snf7-3; 2010012P02Rik; 2210015K02Rik; 2310010I16Rik
NCBI Protein Information
charged multivesicular body protein 4c
UniProt Protein Name
Charged multivesicular body protein 4c
UniProt Gene Name
Chmp4c
UniProt Synonym Gene Names
CHMP4c
UniProt Entry Name
CHM4C_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CHMP4C chmp4c (Catalog #AAA201378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Chmp4c Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Chmp4c can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHMP4C chmp4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEAFSQRVQF ADGFDEAELL AELEELEQEE LNKKMTSLEL PNVPSSSLPA. It is sometimes possible for the material contained within the vial of "Chmp4c, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.