Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197967_WB13.jpg WB (Western Blot) (WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateCHRFAM7A is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit CHRFAM7A Polyclonal Antibody | anti-CHRFAM7A antibody

CHRFAM7A antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CHRFAM7A; D-10; CHRNA7; NACHRA7; CHRNA7-DR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRFAM7A, Antibody; CHRFAM7A antibody - N-terminal region; anti-CHRFAM7A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC
Sequence Length
412
Applicable Applications for anti-CHRFAM7A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRFAM7A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateCHRFAM7A is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197967_WB13.jpg WB (Western Blot) (WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateCHRFAM7A is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: CHRFAM7ASample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA197967_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CHRFAM7ASample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-CHRFAM7A antibody
This is a rabbit polyclonal antibody against CHRFAM7A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A.
Product Categories/Family for anti-CHRFAM7A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
CHRNA7-FAM7A fusion protein isoform 1
NCBI Official Synonym Full Names
CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion
NCBI Official Symbol
CHRFAM7A
NCBI Official Synonym Symbols
D-10; CHRNA7; NACHRA7; CHRNA7-DR1
NCBI Protein Information
CHRNA7-FAM7A fusion protein
UniProt Protein Name
CHRNA7-FAM7A fusion protein
UniProt Gene Name
CHRFAM7A
UniProt Entry Name
CRFM7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CHRFAM7A chrfam7a (Catalog #AAA197967) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRFAM7A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHRFAM7A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHRFAM7A chrfam7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFQLLIQHLW IAANCDIADE RFDATFHTNV LVNSSGHCQY LPPGIFKSSC. It is sometimes possible for the material contained within the vial of "CHRFAM7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.