Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA11685_FCM9.jpg FCM (Flow Cytometry) (Figure 9. Flow Cytometry analysis of MCF-7 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing MCF-7 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit CHRNA5 Polyclonal Antibody | anti-CHRNA5 antibody

Anti-CHRNA5 Antibody

Gene Names
CHRNA5; LNCR2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
CHRNA5, Antibody; Anti-CHRNA5 Antibody; AChR; CHRNA 5; CHRNA5; LNCR2; NACHRA 5; NACHRA5; P30532; Neuronal acetylcholine receptor subunit alpha-5; cholinergic receptor nicotinic alpha 5 subunit; anti-CHRNA5 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
468
Applicable Applications for anti-CHRNA5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 9. Flow Cytometry analysis of MCF-7 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing MCF-7 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11685_FCM9.jpg FCM (Flow Cytometry) (Figure 9. Flow Cytometry analysis of MCF-7 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing MCF-7 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 8. Flow Cytometry analysis of A549 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing A549 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11685_FCM8.jpg FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of A549 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing A549 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of U251 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing U251 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11685_FCM7.jpg FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of U251 cells using anti-CHRNA5 antibody (AAA11685).Overlay histogram showing U251 cells stained with AAA11685 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA5 Antibody (AAA11685,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of human prostatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CHRNA5 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11685_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of human prostatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CHRNA5 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of rat cardiac muscle tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-FBXL4 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11685_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of rat cardiac muscle tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-FBXL4 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CHRNA5 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11685_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CHRNA5 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of mouse cardiac muscle tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CHRNA5 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11685_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of mouse cardiac muscle tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CHRNA5 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-FBXL4 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11685_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). CHRNA5 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-FBXL4 Antibody (AAA11685) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. lane 1: rat skeletal muscle tissue lysates, lane 2: HEPG2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CHRNA5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CHRNA5 at approximately 53KD. The expected band size for CHRNA5 is at 53KD.)

product-image-AAA11685_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of CHRNA5 using anti-CHRNA5 antibody (AAA11685). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. lane 1: rat skeletal muscle tissue lysates, lane 2: HEPG2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CHRNA5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CHRNA5 at approximately 53KD. The expected band size for CHRNA5 is at 53KD.)
Related Product Information for anti-CHRNA5 antibody
Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection.
Background: Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).
References
1. "Entrez Gene: CHRNA5 cholinergic receptor, nicotinic, alpha 5".
2. Chini, B., Clementi, F., Hukovic, N., Sher, E. Neuronal-type alpha-bungarotoxin receptors and the alpha-5-nicotinic receptor subunit gene are expressed in neuronal and nonneuronal human cell lines. Hum. Genet. 89: 1572-1576, 1992.
3. Wang, J. C., Cruchaga, C., Saccone, N. L., Bertelsen, S., Liu, P., Budde, J. P., Duan, W., Fox, L., Grucza, R. A., Kern, J., Mayo, K., Reyes, O., and 12 others. Risk for nicotine dependence and lung cancer is conferred by mRNA expression levels and amino acid change in CHRNA5. Hum. Molec. Genet. 18: 3125-3135, 2009.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,054 Da
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-5 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 5 subunit
NCBI Official Symbol
CHRNA5
NCBI Official Synonym Symbols
LNCR2
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-5
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-5
UniProt Gene Name
CHRNA5
UniProt Synonym Gene Names
NACHRA5

Similar Products

Product Notes

The CHRNA5 chrna5 (Catalog #AAA11685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CHRNA5 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the CHRNA5 chrna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHRNA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.