Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201710_WB10.jpg WB (Western Blot) (WB Suggested Anti-CHRNA7 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit CHRNA7 Polyclonal Antibody | anti-CHRNA7 antibody

CHRNA7 antibody - N-terminal region

Gene Names
CHRNA7; NACHRA7; CHRNA7-2
Reactivity
Cow, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CHRNA7, Antibody; CHRNA7 antibody - N-terminal region; anti-CHRNA7 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
Sequence Length
502
Applicable Applications for anti-CHRNA7 antibody
WB (Western Blot)
Homology
Cow: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CHRNA7 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA201710_WB10.jpg WB (Western Blot) (WB Suggested Anti-CHRNA7 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RatTarget Name: CHRNA7Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA201710_WB11.jpg WB (Western Blot) (Host: RatTarget Name: CHRNA7Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CHRNA7Sample Type: MDA-MB-435S Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201710_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CHRNA7Sample Type: MDA-MB-435S Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CHRNA7Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA201710_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CHRNA7Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CHRNA7 antibody
This is a rabbit polyclonal antibody against CHRNA7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA7 is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from CHRNA7 and a novel FAM7A gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-7 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 7 subunit
NCBI Official Symbol
CHRNA7
NCBI Official Synonym Symbols
NACHRA7; CHRNA7-2
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-7
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-7
UniProt Gene Name
CHRNA7
UniProt Synonym Gene Names
NACHRA7
UniProt Entry Name
ACHA7_HUMAN

Similar Products

Product Notes

The CHRNA7 chrna7 (Catalog #AAA201710) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNA7 antibody - N-terminal region reacts with Cow, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHRNA7 chrna7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGEFQRKLYK ELVKNYNPLE RPVANDSQPL TVYFSLSLLQ IMDVDEKNQV. It is sometimes possible for the material contained within the vial of "CHRNA7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.