Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197803_WB10.jpg WB (Western Blot) (WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit CIAO1 Polyclonal Antibody | anti-CIAO1 antibody

CIAO1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CIAO1; CIA1; WDR39
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CIAO1, Antibody; CIAO1 antibody - middle region; anti-CIAO1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH
Sequence Length
339
Applicable Applications for anti-CIAO1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CIAO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA197803_WB10.jpg WB (Western Blot) (WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: CIAO1Sample Type: MCF7Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA197803_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CIAO1Sample Type: MCF7Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: CIAO1Sample Type: 721_BAntibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA197803_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CIAO1Sample Type: 721_BAntibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Rabbit Anti-CIAO1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197803_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CIAO1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CIAO1 antibody
This is a rabbit polyclonal antibody against CIAO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
Product Categories/Family for anti-CIAO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
probable cytosolic iron-sulfur protein assembly protein CIAO1
NCBI Official Synonym Full Names
cytosolic iron-sulfur assembly component 1
NCBI Official Symbol
CIAO1
NCBI Official Synonym Symbols
CIA1; WDR39
NCBI Protein Information
probable cytosolic iron-sulfur protein assembly protein CIAO1
UniProt Protein Name
Probable cytosolic iron-sulfur protein assembly protein CIAO1
UniProt Gene Name
CIAO1
UniProt Entry Name
CIAO1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CIAO1 ciao1 (Catalog #AAA197803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIAO1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's CIAO1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CIAO1 ciao1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVLNSHTQDV KHVVWHPSQE LLASASYDDT VKLYREEEDD WVCCATLEGH. It is sometimes possible for the material contained within the vial of "CIAO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.