WB (Western Blot)
(Host: RabbitTarget Name: CIDEASample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human CIDEA Polyclonal Antibody | anti-CIDEA antibody
CIDEA Antibody - middle region
Gene Names
CIDEA; CIDE-A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CIDEA, Antibody; CIDEA Antibody - middle region; anti-CIDEA antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVV
Sequence Length
219
Applicable Applications for anti-CIDEA antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CIDEA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: CIDEASample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CIDEASample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: CIDEASample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: CIDEASample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-CIDEA antibody
This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified.
Product Categories/Family for anti-CIDEA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
cell death activator CIDE-A isoform 1
NCBI Official Synonym Full Names
cell death inducing DFFA like effector a
NCBI Official Symbol
CIDEA
NCBI Official Synonym Symbols
CIDE-A
NCBI Protein Information
cell death activator CIDE-A
UniProt Protein Name
Cell death activator CIDE-A
UniProt Gene Name
CIDEA
UniProt Entry Name
CIDEA_HUMAN
Similar Products
Product Notes
The CIDEA cidea (Catalog #AAA201572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIDEA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CIDEA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CIDEA cidea for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPFRVSNHDR SSRRGVMASS LQELISKTLD ALVIATGLVT LVLEEDGTVV. It is sometimes possible for the material contained within the vial of "CIDEA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.