Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282399_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and Claudin 1 Rabbit pAb knockout (KO) HepG2(KD) cells, using Claudin 1 Rabbit pAb (AAA282399) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)

Rabbit anti-Human Claudin 1 Polyclonal Antibody | anti-CLDN1 antibody

[KO Validated] Claudin 1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CLDN1; CLD1; SEMP1; ILVASC
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
Claudin 1, Antibody; [KO Validated] Claudin 1 Rabbit pAb; CLD1; SEMP1; ILVASC; anti-CLDN1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
TAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Applicable Applications for anti-CLDN1 antibody
WB (Western Blot)
Positive Samples
A-431
Cellular Location
Cell junction, Cell membrane, Multi-pass membrane protein, tight junction
Research Area
Signal Transduction, Cell Biology Developmental Biology, Cell Adhesion, Tight Junctions, Cytoskeleton
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 137-211 of human Claudin 1 (NP_066924.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and Claudin 1 Rabbit pAb knockout (KO) HepG2(KD) cells, using Claudin 1 Rabbit pAb (AAA282399) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)

product-image-AAA282399_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and Claudin 1 Rabbit pAb knockout (KO) HepG2(KD) cells, using Claudin 1 Rabbit pAb (AAA282399) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)

WB (Western Blot)

(Western blot analysis of A-431, using Claudin 1 Rabbit pAb (AAA282399) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)

product-image-AAA282399_WB15.jpg WB (Western Blot) (Western blot analysis of A-431, using Claudin 1 Rabbit pAb (AAA282399) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)
Related Product Information for anti-CLDN1 antibody
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome.
Product Categories/Family for anti-CLDN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,744 Da
NCBI Official Full Name
claudin-1
NCBI Official Synonym Full Names
claudin 1
NCBI Official Symbol
CLDN1
NCBI Official Synonym Symbols
CLD1; SEMP1; ILVASC
NCBI Protein Information
claudin-1; senescence-associated epithelial membrane protein 1
UniProt Protein Name
Claudin-1
UniProt Gene Name
CLDN1
UniProt Synonym Gene Names
CLD1; SEMP1
UniProt Entry Name
CLD1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CLDN1 cldn1 (Catalog #AAA282399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Claudin 1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Claudin 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLDN1 cldn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TAWYGNRIVQ EFYDPMTPVN ARYEFGQALF TGWAAASLCL LGGALLCCSC PRKTTSYPTP RPYPKPAPSS GKDYV. It is sometimes possible for the material contained within the vial of "Claudin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.