IHC (Immunohiostchemistry)
(Claudin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
Rabbit Claudin 17 Polyclonal Antibody | anti-CLDN17 antibody
Claudin 17 antibody
Reactivity
Human, Mouse, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
Claudin 17, Antibody; Claudin 17 antibody; Polyclonal Claudin 17; Anti-Claudin 17; Claudin 17; Claudin -17; CLDN17; anti-CLDN17 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
Claudin 17 antibody was raised against the middle region of CLDN17
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN17 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
224
Applicable Applications for anti-CLDN17 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
IHC (Immunohiostchemistry)
(Claudin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
IHC (Immunohiostchemistry)
(Claudin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
WB (Western Blot)
(Claudin 17 antibody (AAA224375) used at 2 ug/ml to detect target protein.)
WB (Western Blot)
(Claudin 17 antibody (AAA224375) used at 2 ug/ml to detect target protein.)
Related Product Information for anti-CLDN17 antibody
Rabbit polyclonal Claudin 17 antibody raised against the middle region of CLDN17
Product Categories/Family for anti-CLDN17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25 kDa (MW of target protein)
NCBI Official Full Name
claudin-17
NCBI Official Synonym Full Names
claudin 17
NCBI Official Symbol
CLDN17
NCBI Protein Information
claudin-17
UniProt Protein Name
Claudin-17
UniProt Gene Name
CLDN17
UniProt Entry Name
CLD17_HUMAN
Similar Products
Product Notes
The CLDN17 cldn17 (Catalog #AAA224375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Claudin 17 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Claudin 17 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CLDN17 cldn17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Claudin 17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.