Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281249_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CLCA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.)

Rabbit anti-Mouse, Rat CLCA1 Polyclonal Antibody | anti-CLCA1 antibody

CLCA1 Polyclonal Antibody

Gene Names
CLCA1; CACC; GOB5; CACC1; CLCRG1; CaCC-1; hCLCA1; hCaCC-1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CLCA1, Antibody; CLCA1 Polyclonal Antibody; CACC; CaCC-1; CACC1; CLCRG1; GOB5; hCaCC-1; hCLCA1; anti-CLCA1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQ
Sequence Length
914
Applicable Applications for anti-CLCA1 antibody
WB (Western Blot)
Immunogen
Recombinant protein of human CLCA1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Extracellular side, Peripheral membrane protein, Secreted, extracellular space
Positive Samples
mouse uterus, rat small intestine
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CLCA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.)

product-image-AAA281249_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CLCA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.)
Related Product Information for anti-CLCA1 antibody
This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
Product Categories/Family for anti-CLCA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 100kDa
Observed: 85kDa
NCBI Official Full Name
calcium-activated chloride channel regulator 1
NCBI Official Synonym Full Names
chloride channel accessory 1
NCBI Official Symbol
CLCA1
NCBI Official Synonym Symbols
CACC; GOB5; CACC1; CLCRG1; CaCC-1; hCLCA1; hCaCC-1
NCBI Protein Information
calcium-activated chloride channel regulator 1
UniProt Protein Name
Calcium-activated chloride channel regulator 1
UniProt Gene Name
CLCA1
UniProt Synonym Gene Names
CACC1; hCLCA1; CaCC-1; hCaCC-1

Similar Products

Product Notes

The CLCA1 clca1 (Catalog #AAA281249) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLCA1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLCA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLCA1 clca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NSLIQLNNNG YEGIVVAIDP NVPEDETLIQ QIKDMVTQAS LYLFEATGKR FYFKNVAILI PETWKTKADY VRPKLETYKN ADVLVAESTP PGNDEPYTEQ MGNCGEKGER IHLTPDFIAG KKLAEYGPQ. It is sometimes possible for the material contained within the vial of "CLCA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.