Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197938_WB13.jpg WB (Western Blot) (WB Suggested Anti-CLCA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit CLCA2 Polyclonal Antibody | anti-CLCA2 antibody

CLCA2 antibody - C-terminal region

Gene Names
CLCA2; CACC; CACC3; CLCRG2; CaCC-3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLCA2, Antibody; CLCA2 antibody - C-terminal region; anti-CLCA2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM
Sequence Length
943
Applicable Applications for anti-CLCA2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 77%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLCA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CLCA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

product-image-AAA197938_WB13.jpg WB (Western Blot) (WB Suggested Anti-CLCA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: CLCA2Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197938_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CLCA2Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-CLCA2 antibody
This is a rabbit polyclonal antibody against CLCA2. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same site on chromosome 1p31-p22 and share high degrees of homology in size, sequence and predicted structure, but differ significantly in their tissue distributions. Since this protein is expressed predominantly in trachea and lung, it is suggested to play a role in the complex pathogenesis of cystic fibrosis. It may also serve as adhesion molecule for lung metastatic cancer cells, mediating vascular arrest and colonization, and furthermore, it has been implicated to act as a tumor suppressor gene for breast cancer.
Product Categories/Family for anti-CLCA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104kDa
NCBI Official Full Name
calcium-activated chloride channel regulator 2 preproprotein
NCBI Official Synonym Full Names
chloride channel accessory 2
NCBI Official Symbol
CLCA2
NCBI Official Synonym Symbols
CACC; CACC3; CLCRG2; CaCC-3
NCBI Protein Information
calcium-activated chloride channel regulator 2
UniProt Protein Name
Calcium-activated chloride channel regulator 2
UniProt Gene Name
CLCA2
UniProt Synonym Gene Names
CACC3; hCLCA2; CaCC-3; hCaCC-3
UniProt Entry Name
CLCA2_HUMAN

Similar Products

Product Notes

The CLCA2 clca2 (Catalog #AAA197938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLCA2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLCA2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLCA2 clca2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RYFFSFAANG RYSLKVHVNH SPSISTPAHS IPGSHAMYVP GYTANGNIQM. It is sometimes possible for the material contained within the vial of "CLCA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.