Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-Clcn5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)

Rabbit Clcn5 Polyclonal Antibody | anti-CLCN5 antibody

Clcn5 antibody - middle region

Gene Names
Clcn5; Clc5; ClC-5; Sfc13; Clc4-1; T25545; Clcn4-1; DXImx42e; 5430408K11Rik; D930009B12Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Clcn5, Antibody; Clcn5 antibody - middle region; anti-CLCN5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL
Sequence Length
746
Applicable Applications for anti-CLCN5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Clcn5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)

WB (Western Blot) (WB Suggested Anti-Clcn5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Rat MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Rat MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Rat LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Rat LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Rat LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Rat LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Rat BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Rat BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Mouse SpleenAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Mouse SpleenAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Mouse LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Mouse LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Mouse KidneyAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Mouse KidneyAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Mouse HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Mouse HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: Clcn5Sample Type: Mouse BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: Clcn5Sample Type: Mouse BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CLCN5 antibody
This is a rabbit polyclonal antibody against Clcn5. It was validated on Western Blot

Target Description: Clcn5 is a proton-coupled chloride transporter. Clcn5 functions as antiport system and exchanges chloride ions against protons. Clcn5 is important for normal acidification of the endosome lumen.Clcn5 may play an important role in renal tubular function.
Product Categories/Family for anti-CLCN5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
H(+)/Cl(-) exchange transporter 5 isoform 1
NCBI Official Synonym Full Names
chloride channel, voltage-sensitive 5
NCBI Official Symbol
Clcn5
NCBI Official Synonym Symbols
Clc5; ClC-5; Sfc13; Clc4-1; T25545; Clcn4-1; DXImx42e; 5430408K11Rik; D930009B12Rik
NCBI Protein Information
H(+)/Cl(-) exchange transporter 5
UniProt Protein Name
H(+)/Cl(-) exchange transporter 5
UniProt Gene Name
Clcn5
UniProt Synonym Gene Names
Clc5; ClC-5
UniProt Entry Name
CLCN5_MOUSE

Similar Products

Product Notes

The CLCN5 clcn5 (Catalog #AAA23438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Clcn5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Clcn5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLCN5 clcn5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVVIMFELTG GLEYIVPLMA AAMTSKWVAD ALGREGIYDA HIRLNGYPFL. It is sometimes possible for the material contained within the vial of "Clcn5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.