Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197631_WB11.jpg WB (Western Blot) (WB Suggested Anti-CLDN11 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit CLDN11 Polyclonal Antibody | anti-CLDN11 antibody

CLDN11 antibody - C-terminal region

Gene Names
CLDN11; OSP; OTM
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CLDN11, Antibody; CLDN11 antibody - C-terminal region; anti-CLDN11 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Sequence Length
207
Applicable Applications for anti-CLDN11 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CLDN11 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

product-image-AAA197631_WB11.jpg WB (Western Blot) (WB Suggested Anti-CLDN11 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

IHC (Immunohiostchemistry)

(Immunohistochemistry of formalin-fixed, paraffin-embedded human brain, cortex, white matter tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA197631_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human brain, cortex, white matter tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Human Muscle)

product-image-AAA197631_IHC15.jpg IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-CLDN11 antibody
This is a rabbit polyclonal antibody against CLDN11. It was validated on Western Blot and immunohistochemistry

Target Description: CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.The protein encoded by this gene belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
claudin-11 isoform 1
NCBI Official Synonym Full Names
claudin 11
NCBI Official Symbol
CLDN11
NCBI Official Synonym Symbols
OSP; OTM
NCBI Protein Information
claudin-11
UniProt Protein Name
Claudin-11
UniProt Gene Name
CLDN11
UniProt Synonym Gene Names
OSP; OTM
UniProt Entry Name
CLD11_HUMAN

Similar Products

Product Notes

The CLDN11 cldn11 (Catalog #AAA197631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLDN11 antibody - C-terminal region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLDN11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CLDN11 cldn11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSFGYSLYAG WIGAVLCLVG GCVILCCAGD AQAFGENRFY YTAGSSSPTH. It is sometimes possible for the material contained within the vial of "CLDN11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.