Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197683_WB8.jpg WB (Western Blot) (WB Suggested Anti-CNP Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateCNP is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit CNP Polyclonal Antibody | anti-CNP antibody

CNP antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CNP; CNP1
Reactivity
Cow, Dog, Horse, Human, Pig, Rat, Sheep
Applications
Western Blot, Immunoprecipitation
Purity
Protein A purified
Synonyms
CNP, Antibody; CNP antibody - N-terminal region; anti-CNP antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Sequence Length
401
Applicable Applications for anti-CNP antibody
WB (Western Blot), IP (Immunoprecipitation)
Homology
Cow: 85%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 77%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CNP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CNP Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateCNP is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197683_WB8.jpg WB (Western Blot) (WB Suggested Anti-CNP Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateCNP is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Lanes:1. Human NT-2 cells (60ug) lysate 2. Rat brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:CNPSubmitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA197683_WB10.jpg WB (Western Blot) (Lanes:1. Human NT-2 cells (60ug) lysate 2. Rat brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:CNPSubmitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IP (Immunoprecipitation)

(IP Suggested Anti-CNP AntibodyPositive Control: NT2 CELL/BRAIN TISSUE)

product-image-AAA197683_IP11.jpg IP (Immunoprecipitation) (IP Suggested Anti-CNP AntibodyPositive Control: NT2 CELL/BRAIN TISSUE)

IP (Immunoprecipitation)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :CNPPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :CNPSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA197683_IP13.jpg IP (Immunoprecipitation) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :CNPPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :CNPSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Rabbit Anti-CNP antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197683_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CNP antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-CNP antibody
This is a rabbit polyclonal antibody against CNP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase isoform 1
NCBI Official Synonym Full Names
2',3'-cyclic nucleotide 3' phosphodiesterase
NCBI Official Symbol
CNP
NCBI Official Synonym Symbols
CNP1
NCBI Protein Information
2',3'-cyclic-nucleotide 3'-phosphodiesterase
UniProt Protein Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase
UniProt Gene Name
CNP
UniProt Synonym Gene Names
CNP; CNPase
UniProt Entry Name
CN37_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CNP cnp (Catalog #AAA197683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNP antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CNP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation). Researchers should empirically determine the suitability of the CNP cnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKITPGARGA FSEEYKRLDE DLAAYCRRRD IRILVLDDTN HERERLEQLF. It is sometimes possible for the material contained within the vial of "CNP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.