Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200475_WB13.jpg WB (Western Blot) (WB Suggested Anti-COG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateCOG4 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit COG4 Polyclonal Antibody | anti-COG4 antibody

COG4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
COG4; COD1; CDG2J; SWILS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COG4, Antibody; COG4 antibody - middle region; anti-COG4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ
Sequence Length
789
Applicable Applications for anti-COG4 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human COG4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateCOG4 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200475_WB13.jpg WB (Western Blot) (WB Suggested Anti-COG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateCOG4 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with Myc-COG4 (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

product-image-AAA200475_WB15.jpg WB (Western Blot) (Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with Myc-COG4 (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)
Related Product Information for anti-COG4 antibody
This is a rabbit polyclonal antibody against COG4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-265 AK096557.1 1-265 266-555 BP282697.1 230-519 556-1072 AU125729.1 34-550 1073-2838 AL050101.1 375-2140
Product Categories/Family for anti-COG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
conserved oligomeric Golgi complex subunit 4 isoform 1
NCBI Official Synonym Full Names
component of oligomeric golgi complex 4
NCBI Official Symbol
COG4
NCBI Official Synonym Symbols
COD1; CDG2J; SWILS
NCBI Protein Information
conserved oligomeric Golgi complex subunit 4
UniProt Protein Name
Conserved oligomeric Golgi complex subunit 4
UniProt Gene Name
COG4
UniProt Synonym Gene Names
COG complex subunit 4
UniProt Entry Name
COG4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The COG4 cog4 (Catalog #AAA200475) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COG4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COG4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COG4 cog4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFSQGIGGEQ AQAKFDSCLS DLAAVSNKFR DLLQEGLTEL NSTAIKPQVQ. It is sometimes possible for the material contained within the vial of "COG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.