IF (Immunofluorescence)
(Immunofluorescence analysis of rat trachea using COL2A1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Rabbit anti-Mouse, Rat COL2A1 Polyclonal Antibody | anti-COL2A1 antibody
COL2A1 Rabbit pAb
Gene Names
ABCC4; MRP4; MOATB; MOAT-B
Reactivity
Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
COL2A1, Antibody; COL2A1 Rabbit pAb; COL2A1; ANFH; AOM; COL11A3; SEDC; STL1; anti-COL2A1 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
SQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL
Applicable Applications for anti-COL2A1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Mouse skeletal muscle
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human COL2A1 (NP_001835.3).
Cellular Location
Secreted, extracellular matrix, extracellular space
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of rat trachea using COL2A1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of rat trachea using COL2A1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts of Mouse skeletal muscle, using COL2A1 antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of extracts of Mouse skeletal muscle, using COL2A1 antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
Related Product Information for anti-COL2A1 antibody
This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene.
Product Categories/Family for anti-COL2A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
1325
NCBI Official Full Name
Multidrug resistance-associated protein 4
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family C (CFTR/MRP), member 4
NCBI Official Symbol
ABCC4
NCBI Official Synonym Symbols
MRP4; MOATB; MOAT-B
NCBI Protein Information
multidrug resistance-associated protein 4; MRP/cMOAT-related ABC transporter; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); canalicular multispecific organic anion transporter (ABC superfa
UniProt Protein Name
Multidrug resistance-associated protein 4
UniProt Gene Name
ABCC4
UniProt Synonym Gene Names
MRP4; MOAT-B
UniProt Entry Name
MRP4_HUMAN
Similar Products
Product Notes
The COL2A1 abcc4 (Catalog #AAA282251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL2A1 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COL2A1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the COL2A1 abcc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQEKVGIVGR TGAGKSSLIS ALFRLSEPEG KIWIDKILTT EIGLHDLRKK MSIIPQEPVL FTGTMRKNLD PFNEHTDEEL WNALQEVQLK ETIEDLPGKM DTELAESGSN FSVGQRQLVC LARAILRKNQ ILIIDEATAN VDPRTDELIQ KKIREKFAHC TVLTIAHRLN TIIDSDKIMV LDSGRLKEYD EPYVLLQNKE SLFYKMVQQL GKAEAAALTE TAKQVYFKRN YPHIGHTDHM VTNTSNGQPS TLTIFETAL. It is sometimes possible for the material contained within the vial of "COL2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.