WB (Western Blot)
(WB Suggested Anti-COL5A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Rabbit COL5A1 Polyclonal Antibody | anti-COL5A1 antibody
COL5A1 antibody - N-terminal region
Gene Names
COL5A1; EDSC; EDSCL1
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COL5A1, Antibody; COL5A1 antibody - N-terminal region; anti-COL5A1 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG
Sequence Length
1838
Applicable Applications for anti-COL5A1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COL5A1
Protein Size (# AA)
1838 amino acids
Protein Interactions
PDGFB; PDGFA; SIRT7; UBC; LGALS3BP; THBS1; SDC3; DCN; COL5A3; BMP1; MAG; SPARC; Igfbp7;
Blocking Peptide
For anti-COL5A1 (MBS3214620) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-COL5A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(WB Suggested Anti-COL5A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-COL5A1 antibody
This is a rabbit polyclonal antibody against COL5A1. It was validated on Western Blot
Target Description: This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II.
Target Description: This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II.
Product Categories/Family for anti-COL5A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183kDa
NCBI Official Full Name
collagen alpha-1(V) chain isoform 1 preproprotein
NCBI Official Synonym Full Names
collagen type V alpha 1 chain
NCBI Official Symbol
COL5A1
NCBI Official Synonym Symbols
EDSC; EDSCL1
NCBI Protein Information
collagen alpha-1(V) chain
UniProt Protein Name
Collagen alpha-1(V) chain
UniProt Gene Name
COL5A1
UniProt Entry Name
CO5A1_HUMAN
Similar Products
Product Notes
The COL5A1 col5a1 (Catalog #AAA200982) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL5A1 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COL5A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COL5A1 col5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGMPANQDTI YEGIGGPRGE KGQKGEPAII EPGMLIEGPP GPEGPAGLPG. It is sometimes possible for the material contained within the vial of "COL5A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.