WB (Western Blot)
(WB Suggested Anti-COQ2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: DU145 cell lysateCOQ2 is supported by BioGPS gene expression data to be expressed in DU145)
Rabbit COQ2 Polyclonal Antibody | anti-COQ2 antibody
COQ2 antibody - middle region
Gene Names
COQ2; MSA1; CL640; COQ10D1; PHB:PPT
Reactivity
Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COQ2, Antibody; COQ2 antibody - middle region; anti-COQ2 antibody
Host
Rabbit
Reactivity
Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Sequence Length
384
Applicable Applications for anti-COQ2 antibody
WB (Western Blot)
Homology
Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human COQ2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-COQ2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: DU145 cell lysateCOQ2 is supported by BioGPS gene expression data to be expressed in DU145)
WB (Western Blot)
(WB Suggested Anti-COQ2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: DU145 cell lysateCOQ2 is supported by BioGPS gene expression data to be expressed in DU145)
WB (Western Blot)
(Host: RabbitTarget Name: COQ2Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: COQ2Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-COQ2 antibody
This is a rabbit polyclonal antibody against COQ2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
Target Description: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
Product Categories/Family for anti-COQ2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform 1
NCBI Official Synonym Full Names
coenzyme Q2, polyprenyltransferase
NCBI Official Symbol
COQ2
NCBI Official Synonym Symbols
MSA1; CL640; COQ10D1; PHB:PPT
NCBI Protein Information
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Protein Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Gene Name
COQ2
UniProt Synonym Gene Names
CL640; hCOQ2
UniProt Entry Name
COQ2_HUMAN
Similar Products
Product Notes
The COQ2 coq2 (Catalog #AAA199778) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COQ2 antibody - middle region reacts with Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COQ2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COQ2 coq2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSGVMWTLIY DTIYAHQDKR DDVLIGLKST ALRFGENTKP WLSGFSVAML. It is sometimes possible for the material contained within the vial of "COQ2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.