Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201187_WB13.jpg WB (Western Blot) (WB Suggested Anti-COQ9 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole CellCOQ9 is supported by BioGPS gene expression data to be expressed in HCT15)

Rabbit COQ9 Polyclonal Antibody | anti-COQ9 antibody

COQ9 antibody - N-terminal region

Gene Names
COQ9; COQ10D5; C16orf49
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
COQ9, Antibody; COQ9 antibody - N-terminal region; anti-COQ9 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGE
Sequence Length
318
Applicable Applications for anti-COQ9 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 79%; Guinea Pig: 75%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 83%; Rat: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COQ9 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole CellCOQ9 is supported by BioGPS gene expression data to be expressed in HCT15)

product-image-AAA201187_WB13.jpg WB (Western Blot) (WB Suggested Anti-COQ9 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole CellCOQ9 is supported by BioGPS gene expression data to be expressed in HCT15)

IHC (Immunohistochemistry)

(Rabbit Anti-COQ9 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201187_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-COQ9 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-COQ9 antibody
This is a rabbit polyclonal antibody against COQ9. It was validated on Western Blot

Target Description: This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.
Product Categories/Family for anti-COQ9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
ubiquinone biosynthesis protein COQ9, mitochondrial
NCBI Official Synonym Full Names
coenzyme Q9
NCBI Official Symbol
COQ9
NCBI Official Synonym Symbols
COQ10D5; C16orf49
NCBI Protein Information
ubiquinone biosynthesis protein COQ9, mitochondrial
UniProt Protein Name
Ubiquinone biosynthesis protein COQ9, mitochondrial
UniProt Gene Name
COQ9
UniProt Synonym Gene Names
C16orf49
UniProt Entry Name
COQ9_HUMAN

Similar Products

Product Notes

The COQ9 coq9 (Catalog #AAA201187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COQ9 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COQ9 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the COQ9 coq9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASAVGLRSSD EQKQQPPNSF SQQHSETQGA EKPDPESSHS PPRYTDQGGE. It is sometimes possible for the material contained within the vial of "COQ9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.