IF (Immunofluorescence)
(Immunofluorescence analysis of 293T cells transfected with SARS-COV-2 Spike RBD protein and untreated 293T cells use SARS-COV-2 Spike RBD Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Mouse anti-SARS-CoV-2 COVID 19 Spike RBD Coronavirus Polyclonal Antibody | anti-COVID-19 antibody
SARS-CoV-2 Spike RBD Mouse mAb, BSA free
Gene Names
TNC; GP; JI; TN; HXB; GMEM; TN-C; 150-225
Reactivity
SARS-CoV-2
Applications
Immunocytochemistry, Immunofluorescence, Western Blot, Dot Blot
Purity
Affinity purification
Synonyms
COVID 19 Spike RBD Coronavirus, Antibody; SARS-CoV-2 Spike RBD Mouse mAb, BSA free; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; S1-RBD protein; NCP-CoV RBD Protein; novel coronavirus RBD Protein; 2019-nCoV RBD Protein; S glycoprotein Subunit1 RBD Protein; anti-COVID-19 antibody
Host
Mouse
Reactivity
SARS-CoV-2
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Applicable Applications for anti-COVID-19 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot), DB (Dot Blot)
Positive Samples
293T
Immunogen
Recombinant fusion protein of SARS-CoV-2 CoV spike RBD.
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of 293T cells transfected with SARS-COV-2 Spike RBD protein and untreated 293T cells use SARS-COV-2 Spike RBD Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of 293T cells transfected with SARS-COV-2 Spike RBD protein and untreated 293T cells use SARS-COV-2 Spike RBD Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Application Data
(Immobilized Recombinant SARS-CoV-2 Spike RBD Protein at 1 ug/mL (100 uL/well) can bind SARS-CoV-2 Spike RBD mAb with a linear range of 0.78-50ng/mL.)
Application Data
(Immobilized Recombinant SARS-CoV-2 Spike RBD Protein at 1 ug/mL (100 uL/well) can bind SARS-CoV-2 Spike RBD mAb with a linear range of 0.78-50ng/mL.)
WB (Western Blot)
(Western blot analysis of extracts of 293T cells, using SARS-CoV-2 Spike RBD Mouse mAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of extracts of 293T cells, using SARS-CoV-2 Spike RBD Mouse mAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
Related Product Information for anti-COVID-19 antibody
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. The spike is essential for both host specificity and viral infectivity. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. It''s been reported that SARS-CoV-2 (COVID-19 coronavirus, 2019-nCoV) can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. The main functions for the Spike protein are summarized as: Mediate receptor binding and membrane fusion; Defines the range of the hosts and specificity of the virus; Main component to bind with the neutralizing antibody; Key target for vaccine design; Can be transmitted between different hosts through gene recombination or mutation of the receptor binding domain (RBD), leading to a higher mortality rate.
Product Categories/Family for anti-COVID-19 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
240,853 Da
NCBI Official Full Name
tenascin
NCBI Official Synonym Full Names
tenascin C
NCBI Official Symbol
TNC
NCBI Official Synonym Symbols
GP; JI; TN; HXB; GMEM; TN-C; 150-225
NCBI Protein Information
tenascin; GP 150-225; cytotactin; neuronectin; myotendinous antigen; hexabrachion (tenascin); tenascin-C isoform 14/AD1/16; glioma-associated-extracellular matrix antigen
UniProt Protein Name
Tenascin
UniProt Gene Name
TNC
UniProt Synonym Gene Names
HXB; TN; TN-C
UniProt Entry Name
TENA_HUMAN
Similar Products
Product Notes
The COVID-19 tnc (Catalog #AAA282197) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SARS-CoV-2 Spike RBD Mouse mAb, BSA free reacts with SARS-CoV-2 and may cross-react with other species as described in the data sheet. AAA Biotech's COVID 19 Spike RBD Coronavirus can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot), DB (Dot Blot). Researchers should empirically determine the suitability of the COVID-19 tnc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NGDTTSGLYT IYLNGDKAEA LEVFCDMTSD GGGWIVFLRR KNGRENFYQN WKAYAAGFGD RREEFWLGLD NLNKITAQGQ YELRVDLRDH GETAFAVYDK FSVGDAKTRY KLKVEGYSGT AGDSMAYHNG RSFSTFDKDT DSAITNCALS YKGAFWYRNC HRVNLMGRYG DNNHSQGVNW FHWKGHEHSI QFAEMKLRPS NFRNLEGRRK RA. It is sometimes possible for the material contained within the vial of "COVID 19 Spike RBD Coronavirus, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.