Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201326_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: COX7A1Sample Type: Human HeartLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

Rabbit COX7A1 Polyclonal Antibody | anti-COX7A1 antibody

COX7A1 antibody - N-terminal region

Gene Names
COX7A1; COX7A; COX7AH; COX7AM
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COX7A1, Antibody; COX7A1 antibody - N-terminal region; anti-COX7A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVT
Sequence Length
79
Applicable Applications for anti-COX7A1 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Horse: 79%; Human: 100%; Mouse: 75%; Pig: 79%; Rabbit: 77%; Sheep: 79%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: COX7A1Sample Type: Human HeartLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

product-image-AAA201326_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: COX7A1Sample Type: Human HeartLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

WB (Western Blot)

(Host: RabbitTarget Name: COX7A1Antibody Dilution: 1.0ug/mlSample Type: Human heart)

product-image-AAA201326_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: COX7A1Antibody Dilution: 1.0ug/mlSample Type: Human heart)
Related Product Information for anti-COX7A1 antibody
This is a rabbit polyclonal antibody against COX7A1. It was validated on Western Blot

Target Description: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
cytochrome c oxidase subunit 7A1, mitochondrial
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 7A1
NCBI Official Symbol
COX7A1
NCBI Official Synonym Symbols
COX7A; COX7AH; COX7AM
NCBI Protein Information
cytochrome c oxidase subunit 7A1, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 7A1, mitochondrial
UniProt Gene Name
COX7A1
UniProt Synonym Gene Names
COX7AH; Cytochrome c oxidase subunit VIIa-H; Cytochrome c oxidase subunit VIIa-M
UniProt Entry Name
CX7A1_HUMAN

Similar Products

Product Notes

The COX7A1 cox7a1 (Catalog #AAA201326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COX7A1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COX7A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COX7A1 cox7a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQALIRSFSS TARNRFQNRV REKQKLFQED NDIPLYLKGG IVDNILYRVT. It is sometimes possible for the material contained within the vial of "COX7A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.