Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200817_WB8.jpg WB (Western Blot) (WB Suggested Anti-CPE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateCPE is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit CPE Polyclonal Antibody | anti-CPE antibody

CPE antibody - N-terminal region

Gene Names
CPE; CPH
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CPE, Antibody; CPE antibody - N-terminal region; anti-CPE antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Sequence Length
476
Applicable Applications for anti-CPE antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CPE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CPE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateCPE is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA200817_WB8.jpg WB (Western Blot) (WB Suggested Anti-CPE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateCPE is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: CPESample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200817_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: CPESample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CPESample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200817_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CPESample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CPESample Type: HepG2Antibody Dilution: 1.0ug/mlCPE is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA200817_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CPESample Type: HepG2Antibody Dilution: 1.0ug/mlCPE is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

IHC (Immunohistochemistry)

(Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-CPE antibody)

product-image-AAA200817_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-CPE antibody)
Related Product Information for anti-CPE antibody
This is a rabbit polyclonal antibody against CPE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
carboxypeptidase E preproprotein
NCBI Official Synonym Full Names
carboxypeptidase E
NCBI Official Symbol
CPE
NCBI Official Synonym Symbols
CPH
NCBI Protein Information
carboxypeptidase E
UniProt Protein Name
Carboxypeptidase E
UniProt Gene Name
CPE
UniProt Synonym Gene Names
CPE; CPH
UniProt Entry Name
CBPE_HUMAN

Similar Products

Product Notes

The CPE cpe (Catalog #AAA200817) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPE antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CPE can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CPE cpe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMRRRRRLQQ EDGISFEYHR YPELREALVS VWLQCTAISR IYTVGRSFEG. It is sometimes possible for the material contained within the vial of "CPE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.