Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46229_IHC8.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in frozen section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

CPT1B Polyclonal Antibody | anti-CPT1B antibody

Anti-CPT1B Antibody

Average rating 0.0
No ratings yet
Gene Names
CPT1B; CPTI; CPT1M; MCPT1; CPT1-M; CPTI-M; M-CPT1; MCCPT1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CPT1B, Antibody; Anti-CPT1B Antibody; Carnitine O-palmitoyltransferase 1; muscle isoform; Carnitine O palmitoyltransferase I mitochondrial muscle isoform; Carnitine O palmitoyltransferase I muscle isoform; Carnitine O-palmitoyl transferase 1, muscle isoform; Carnitine O-palmitoyltransferase I; Carnitine palmitoyltransferase 1A (muscle); Carnitine palmitoyltransferase 1B (muscle); Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase I like protein; Carnitine palmitoyltransferase I muscle; Carnitine palmitoyltransferase I-like protein; CPT 1B; CPT I; CPT1 M; CPT1 muscle; CPT1-M; Cpt1b; CPT1B_HUMAN; CPT1M; CPTI; CPTI M; CPTI muscle; CPTI-M; CPTIM; FLJ55729; FLJ58750; KIAA1670; M CPT1; M-CPT1; MCCPT1; MCPT1; carnitine palmitoyltransferase 1B (muscle); anti-CPT1B antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
738
Applicable Applications for anti-CPT1B antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in frozen section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46229_IHC8.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in frozen section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in frozen section of mouse cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46229_IHC10.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in frozen section of mouse cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemisry)

(Figure 3. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46229_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in paraffin-embedded section of Mouse Skeletal Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46229_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of CPT1B using anti-CPT1B antibody (AAA46229).CPT1B was detected in paraffin-embedded section of Mouse Skeletal Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CPT1B Antibody (AAA46229) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of CPT1B using anti-CPT1B antibody (AAA46229).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Skeletal Muscle Tissue Lysate,Lane 2: Rat Cardiac Muscle Tissue Lysate,Lane 3: Mouse Skeletal Muscle Tissue Lysate,Lane 4: Mouse Cardiac Muscle Tissue Lysate,Lane 5: HELA Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CPT1B antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CPT1B at approximately 88KD. The expected band size for CPT1B is at 88KD.)

product-image-AAA46229_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of CPT1B using anti-CPT1B antibody (AAA46229).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Skeletal Muscle Tissue Lysate,Lane 2: Rat Cardiac Muscle Tissue Lysate,Lane 3: Mouse Skeletal Muscle Tissue Lysate,Lane 4: Mouse Cardiac Muscle Tissue Lysate,Lane 5: HELA Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CPT1B antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CPT1B at approximately 88KD. The expected band size for CPT1B is at 88KD.)
Related Product Information for anti-CPT1B antibody
Description: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
References
1. Auinger A; Rubin D; Sabandal M; Helwig U; Rüther A; Schreiber S; Foelsch UR; Döring F; Schrezenmeir J. "A common haplotype of carnitine palmitoyltransferase 1b is associated with the metabolic syndrome". Br J Nutr, 2013 Mar 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,844 Da
NCBI Official Full Name
carnitine O-palmitoyltransferase 1, muscle isoform isoform c
NCBI Official Synonym Full Names
carnitine palmitoyltransferase 1B
NCBI Official Symbol
CPT1B
NCBI Official Synonym Symbols
CPTI; CPT1M; MCPT1; CPT1-M; CPTI-M; M-CPT1; MCCPT1
NCBI Protein Information
carnitine O-palmitoyltransferase 1, muscle isoform
UniProt Protein Name
Carnitine O-palmitoyltransferase 1, muscle isoform
UniProt Gene Name
CPT1B
UniProt Synonym Gene Names
KIAA1670; CPT1-M; CPT I; CPTI-M
UniProt Entry Name
CPT1B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CPT1B cpt1b (Catalog #AAA46229) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CPT1B Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CPT1B can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CPT1B cpt1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPT1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.