Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200300_WB10.jpg WB (Western Blot) (WB Suggested Anti-CRAT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit CRAT Polyclonal Antibody | anti-CRAT antibody

CRAT antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CRAT; CAT; CAT1; NBIA8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRAT, Antibody; CRAT antibody - N-terminal region; anti-CRAT antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD
Sequence Length
467
Applicable Applications for anti-CRAT antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 91%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CRAT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA200300_WB10.jpg WB (Western Blot) (WB Suggested Anti-CRAT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: CRATSample Type: Human HepG2, Liver, TestisAntibody Dilution: 2.0 ug/ml)

product-image-AAA200300_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CRATSample Type: Human HepG2, Liver, TestisAntibody Dilution: 2.0 ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-CRAT antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA200300_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CRAT antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-CRAT antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA200300_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CRAT antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-CRAT antibody
This is a rabbit polyclonal antibody against CRAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT gene suggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.
Product Categories/Family for anti-CRAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
carnitine acetyltransferase, isoform CRA_a, partial
NCBI Official Synonym Full Names
carnitine O-acetyltransferase
NCBI Official Symbol
CRAT
NCBI Official Synonym Symbols
CAT; CAT1; NBIA8
NCBI Protein Information
carnitine O-acetyltransferase
UniProt Protein Name
Carnitine O-acetyltransferase
UniProt Gene Name
CRAT
UniProt Synonym Gene Names
CAT1; Carnitine acetylase; CAT; CrAT
UniProt Entry Name
CACP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CRAT crat (Catalog #AAA200300) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRAT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CRAT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CRAT crat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKASSRFKAH QDALPRLPVP PLQQSLDHYL KALQPIVSEE EWAHTKQLVD. It is sometimes possible for the material contained within the vial of "CRAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.