Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281571_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse retina using CRB1 antibody at dilution of 1:200 (40x lens).)

Rabbit anti-Human, Mouse CRB1 Polyclonal Antibody | anti-CRB1 antibody

CRB1 Rabbit pAb

Gene Names
CRB1; LCA8; RP12
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CRB1, Antibody; CRB1 Rabbit pAb; CRB1; LCA8; RP12; anti-CRB1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IYIKNSFCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQGRHCDLEVDECASDPCKNEAT
Applicable Applications for anti-CRB1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CRB1 (NP_957705.1).
Cellular Location
Apical cell membrane, Secreted, Single-pass type I membrane protein
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse retina using CRB1 antibody at dilution of 1:200 (40x lens).)

product-image-AAA281571_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse retina using CRB1 antibody at dilution of 1:200 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of HeLa cells, using CRB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

product-image-AAA281571_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of HeLa cells, using CRB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-CRB1 antibody
Background: This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 142 kDa
NCBI Official Full Name
protein crumbs homolog 1 isoform 2
NCBI Official Synonym Full Names
crumbs family member 1, photoreceptor morphogenesis associated
NCBI Official Symbol
CRB1
NCBI Official Synonym Symbols
LCA8; RP12
NCBI Protein Information
protein crumbs homolog 1
UniProt Protein Name
Protein crumbs homolog 1
UniProt Gene Name
CRB1
UniProt Entry Name
CRUM1_HUMAN

Similar Products

Product Notes

The CRB1 crb1 (Catalog #AAA281571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRB1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CRB1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CRB1 crb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IYIKNSFCNK NNTRCLSNSC QNNSTCKDFS KDNDCSCSDT ANNLDKDCDN MKDPCFSNPC QGSATCVNTP GERSFLCKCP PGYSGTICET TIGSCGKNSC QHGGICHQDP IYPVCICPAG YAGRFCEIDH DECASSPCQN GAVCQDGIDG YSCFCVPGYQ GRHCDLEVDE CASDPCKNEA T. It is sometimes possible for the material contained within the vial of "CRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.