Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198534_WB13.jpg WB (Western Blot) (WB Suggested Anti-CREB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateCREB1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Rabbit CREB1 Polyclonal Antibody | anti-CREB1 antibody

CREB1 antibody - middle region

Gene Names
CREB1; CREB; CREB-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CREB1, Antibody; CREB1 antibody - middle region; anti-CREB1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
Sequence Length
341
Applicable Applications for anti-CREB1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CREB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CREB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateCREB1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

product-image-AAA198534_WB13.jpg WB (Western Blot) (WB Suggested Anti-CREB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateCREB1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

WB (Western Blot)

(CREB1 antibody - middle region validated by WB using hek293 cell lysate at 1:500.There is BioGPS gene expression data showing that CREB1 is expressed in HEK293)

product-image-AAA198534_WB15.jpg WB (Western Blot) (CREB1 antibody - middle region validated by WB using hek293 cell lysate at 1:500.There is BioGPS gene expression data showing that CREB1 is expressed in HEK293)
Related Product Information for anti-CREB1 antibody
This is a rabbit polyclonal antibody against CREB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CREB1 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 1 isoform B
NCBI Official Synonym Full Names
cAMP responsive element binding protein 1
NCBI Official Symbol
CREB1
NCBI Official Synonym Symbols
CREB; CREB-1
NCBI Protein Information
cyclic AMP-responsive element-binding protein 1
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 1
UniProt Gene Name
CREB1
UniProt Synonym Gene Names
CREB-1
UniProt Entry Name
CREB1_HUMAN

Similar Products

Product Notes

The CREB1 creb1 (Catalog #AAA198534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREB1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CREB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CREB1 creb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYQIRTAPTS TIAPGVVMAS SPALPTQPAE EAARKREVRL MKNREAAREC. It is sometimes possible for the material contained within the vial of "CREB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.