IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded mouse heart using CREB3 antibody at dilution of 1:100 (40x lens).)
Rabbit anti-Human, Mouse CREB3 Polyclonal Antibody | anti-CREB3 antibody
CREB3 Polyclonal Antibody
Gene Names
CREB3; LZIP; LUMAN; sLZIP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CREB3, Antibody; CREB3 Polyclonal Antibody; LUMAN; LZIP; sLZIP; anti-CREB3 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTC
Sequence Length
371
Applicable Applications for anti-CREB3 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human CREB3 (NP_006359.3).
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded mouse heart using CREB3 antibody at dilution of 1:100 (40x lens).)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded mouse heart using CREB3 antibody at dilution of 1:100 (40x lens).)
WB (Western Blot)
(Western blot analysis of extracts of U-87MG cells, using CREB3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of U-87MG cells, using CREB3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-CREB3 antibody
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.
Product Categories/Family for anti-CREB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 39kDa; 41kDa; 43kDa
Observed: 44kDa
Observed: 44kDa
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3
NCBI Official Symbol
CREB3
NCBI Official Synonym Symbols
LZIP; LUMAN; sLZIP
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 3
UniProt Gene Name
CREB3
UniProt Synonym Gene Names
LZIP; CREB-3; cAMP-responsive element-binding protein 3; N-terminal Luman; Transcriptionally active form
Similar Products
Product Notes
The CREB3 creb3 (Catalog #AAA281110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREB3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CREB3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CREB3 creb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELELDAGDQ DLLAFLLEES GDLGTAPDEA VRAPLDWALP LSEVPSDWEV DDLLCSLLSP PASLNILSSS NPCLVHHDHT YSLPRETVSM DLESESCRKE GTQMTPQHME ELAEQEIARL VLTDEEKSLL EKEGLILPET LPLTKTEEQI LKRVRRKIRN KRSAQESRRK KKVYVGGLES RVLKYTAQNM ELQNKVQLLE EQNLSLLDQL RKLQAMVIEI SNKTSSSSTC. It is sometimes possible for the material contained within the vial of "CREB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.