Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199998_SDS_PAGE10.jpg SDS_PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. 33 kDa and 23 kDa isoforms contain the peptide sequence.)

Rabbit CRLS1 Polyclonal Antibody | anti-CRLS1 antibody

CRLS1 antibody - middle region

Gene Names
CRLS1; CLS; CLS1; GCD10; C20orf155; dJ967N21.6
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRLS1, Antibody; CRLS1 antibody - middle region; anti-CRLS1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN
Sequence Length
301
Applicable Applications for anti-CRLS1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CRLS1
Protein Interactions
FBXO15; PINK1; UBC; MCM6; MCM7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

SDS_PAGE

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. 33 kDa and 23 kDa isoforms contain the peptide sequence.)

product-image-AAA199998_SDS_PAGE10.jpg SDS_PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. 33 kDa and 23 kDa isoforms contain the peptide sequence.)

WB (Western Blot)

(WB Suggested Anti-CRLS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

product-image-AAA199998_WB11.jpg WB (Western Blot) (WB Suggested Anti-CRLS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

IHC (Immunohiostchemistry)

(Rabbit Anti-CRLS1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Tonsil, Skeletal MyocytesPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA199998_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CRLS1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Tonsil, Skeletal MyocytesPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-CRLS1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA199998_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CRLS1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-CRLS1 antibody
This is a rabbit polyclonal antibody against CRLS1. It was validated on Western Blot

Target Description: CRLS1 catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Product Categories/Family for anti-CRLS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
cardiolipin synthase (CMP-forming) isoform 1
NCBI Official Synonym Full Names
cardiolipin synthase 1
NCBI Official Symbol
CRLS1
NCBI Official Synonym Symbols
CLS; CLS1; GCD10; C20orf155; dJ967N21.6
NCBI Protein Information
cardiolipin synthase (CMP-forming)
UniProt Protein Name
Cardiolipin synthase
UniProt Gene Name
CRLS1
UniProt Synonym Gene Names
C20orf155; CLS1; CLS
UniProt Entry Name
CRLS1_HUMAN

Similar Products

Product Notes

The CRLS1 crls1 (Catalog #AAA199998) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRLS1 antibody - middle region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRLS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CRLS1 crls1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WTIPNMLSMT RIGLAPVLGY LIIEEDFNIA LGVFALAGLT DLLDGFIARN. It is sometimes possible for the material contained within the vial of "CRLS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.