Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197751_WB10.jpg WB (Western Blot) (WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateMED17 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit CRSP6 Polyclonal Antibody | anti-MED17 antibody

CRSP6 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MED17; SRB4; CRSP6; CRSP77; DRIP80; TRAP80
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CRSP6, Antibody; CRSP6 antibody - N-terminal region; anti-MED17 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Sequence Length
651
Applicable Applications for anti-MED17 antibody
ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateMED17 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA197751_WB10.jpg WB (Western Blot) (WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateMED17 is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemisry)

(Rabbit Anti-MED17 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197751_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-MED17 AntibodyParaffin Embedded Tissue: Human neural cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohiostchemistry)

(Human Brain)

product-image-AAA197751_IHC13.jpg IHC (Immunohiostchemistry) (Human Brain)

ChIP (Chromatin Immunoprecipitation)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

product-image-AAA197751_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
Related Product Information for anti-MED17 antibody
This is a rabbit polyclonal antibody against CRSP6. It was validated on Western Blot and immunohistochemistry

Target Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by CRSP6 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 17
NCBI Official Synonym Full Names
mediator complex subunit 17
NCBI Official Symbol
MED17
NCBI Official Synonym Symbols
SRB4; CRSP6; CRSP77; DRIP80; TRAP80
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 17
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 17
UniProt Gene Name
MED17
UniProt Synonym Gene Names
ARC77; CRSP6; DRIP77; DRIP80; TRAP80; ARC77; CRSP complex subunit 6; Trap80; DRIP80
UniProt Entry Name
MED17_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MED17 med17 (Catalog #AAA197751) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRSP6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CRSP6 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MED17 med17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAQILLKGAE RLTKSVTENQ ENKLQRDFNS ELLRLRQHWK LRKVGDKILG. It is sometimes possible for the material contained within the vial of "CRSP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.