Rabbit CSDC2 Polyclonal Antibody | anti-CSDC2 antibody
CSDC2 antibody
Gene Names
CSDC2; PIPPIN; dJ347H13.2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
CSDC2, Antibody; CSDC2 antibody; Polyclonal CSDC2; Anti-CSDC2; Cold Shock Domain Containing C2 Rna Binding; anti-CSDC2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
CSDC2 antibody was raised against the N terminal of CSDC2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CSDC2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
153
Applicable Applications for anti-CSDC2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-CSDC2 antibody
Rabbit polyclonal CSDC2 antibody raised against the N terminal of CSDC2
Product Categories/Family for anti-CSDC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
17 kDa (MW of target protein)
NCBI Official Full Name
CSDC2 protein
NCBI Official Synonym Full Names
cold shock domain containing C2, RNA binding
NCBI Official Symbol
CSDC2
NCBI Official Synonym Symbols
PIPPIN; dJ347H13.2
NCBI Protein Information
cold shock domain-containing protein C2
UniProt Protein Name
Cold shock domain-containing protein C2
UniProt Gene Name
CSDC2
UniProt Synonym Gene Names
PIPPIN
UniProt Entry Name
CSDC2_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CSDC2 csdc2 (Catalog #AAA224378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSDC2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSDC2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CSDC2 csdc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSDC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
