WB (Western Blot)
(WB Suggested Anti-CSNK1D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysate)
Rabbit CSNK1D Polyclonal Antibody | anti-CSNK1D antibody
CSNK1D antibody - middle region
Gene Names
CSNK1D; ASPS; CKId; HCKID; FASPS2; CKIdelta; CKI-delta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CSNK1D, Antibody; CSNK1D antibody - middle region; anti-CSNK1D antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
Sequence Length
415
Applicable Applications for anti-CSNK1D antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CSNK1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-CSNK1D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysate)
WB (Western Blot)
(WB Suggested Anti-CSNK1D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: CSNK1DSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CSNK1DSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CSNK1D antibody
This is a rabbit polyclonal antibody against CSNK1D. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is highly similar to the mouse and rat CK1 del
Target Description: This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is highly similar to the mouse and rat CK1 del
Product Categories/Family for anti-CSNK1D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
casein kinase I isoform delta isoform 1
NCBI Official Synonym Full Names
casein kinase 1 delta
NCBI Official Symbol
CSNK1D
NCBI Official Synonym Symbols
ASPS; CKId; HCKID; FASPS2; CKIdelta; CKI-delta
NCBI Protein Information
casein kinase I isoform delta; casein kinase I
UniProt Protein Name
Casein kinase I isoform delta
UniProt Gene Name
CSNK1D
UniProt Synonym Gene Names
HCKID; CKI-delta; CKId
UniProt Entry Name
KC1D_HUMAN
Similar Products
Product Notes
The CSNK1D csnk1d (Catalog #AAA200202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSNK1D antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1D can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CSNK1D csnk1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLVYIIDFGL AKKYRDARTH QHIPYRENKN LTGTARYASI NTHLGIEQSR. It is sometimes possible for the material contained within the vial of "CSNK1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.